Lineage for d6gkba_ (6gkb A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2705161Species Synechococcus sp. [TaxId:64471] [362702] (12 PDB entries)
  8. 2705167Domain d6gkba_: 6gkb A: [362710]
    automated match to d5u1ba_
    complexed with fe

Details for d6gkba_

PDB Entry: 6gkb (more details), 1.9 Å

PDB Description: iron soak structure of y40f synftn
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d6gkba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gkba_ a.25.1.0 (A:) automated matches {Synechococcus sp. [TaxId: 64471]}
vaqgpngralaesmnpdllsaiqqhisieryasvtflamsiwcaerelagfyqffdgeak
deqshavhftqyliarsqsndlqtldaprqnwdslaslmatafqmeadttssiqsvyala
ernsdtrttvfldplieaqiqsedqfayllgrvkfangdptallvidnelragqtqrg

SCOPe Domain Coordinates for d6gkba_:

Click to download the PDB-style file with coordinates for d6gkba_.
(The format of our PDB-style files is described here.)

Timeline for d6gkba_: