Lineage for d6fz4a_ (6fz4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2915760Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2915839Domain d6fz4a_: 6fz4 A: [362701]
    automated match to d4mf3a_
    complexed with cl, ec8, gol, so4

Details for d6fz4a_

PDB Entry: 6fz4 (more details), 1.85 Å

PDB Description: structure of gluk1 ligand-binding domain in complex with n-(7-fluoro- 2,3-dioxo-6-(trifluoromethyl)-3,4-dihydroquinoxalin-1(2h)-yl)-2- hydroxybenzamide at 1.85 a resolution
PDB Compounds: (A:) Glutamate receptor ionotropic, kainate 1,Glutamate receptor ionotropic, kainate 1

SCOPe Domain Sequences for d6fz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fz4a_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyga
qndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpidsa
ddlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvltt
dyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegkl
hmmkekwwrg

SCOPe Domain Coordinates for d6fz4a_:

Click to download the PDB-style file with coordinates for d6fz4a_.
(The format of our PDB-style files is described here.)

Timeline for d6fz4a_: