Lineage for d6cpme_ (6cpm E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539528Protein automated matches [190118] (17 species)
    not a true protein
  7. 2539567Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)
  8. 2539668Domain d6cpme_: 6cpm E: [362691]
    Other proteins in same PDB: d6cpmc1, d6cpmc2, d6cpmd1, d6cpmd2
    automated match to d3rula_
    complexed with ca, edo, gol, na, zn

Details for d6cpme_

PDB Entry: 6cpm (more details), 2.01 Å

PDB Description: structure of the usp15 deubiquitinase domain in complex with a third- generation inhibitory ubv
PDB Compounds: (E:) Ubiquitin variant 15.1d

SCOPe Domain Sequences for d6cpme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cpme_ d.15.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aamqifvktptgkfislevepsdtienvkakiqdkegippdqqrlifrqtwaskqledgr
tlsdyniqkestlhlvlrl

SCOPe Domain Coordinates for d6cpme_:

Click to download the PDB-style file with coordinates for d6cpme_.
(The format of our PDB-style files is described here.)

Timeline for d6cpme_: