Lineage for d6bzrb_ (6bzr B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [186862] (206 PDB entries)
  8. Domain d6bzrb_: 6bzr B: [362671]
    automated match to d2ixfa_
    complexed with adp, cit

Details for d6bzrb_

PDB Entry: 6bzr (more details), 2.8 Å

PDB Description: human abcc6 nbd2 in adp-bound state
PDB Compounds: (B:) Multidrug resistance-associated protein 6

SCOPe Domain Sequences for d6bzrb_:

Sequence, based on SEQRES records: (download)

>d6bzrb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggqiefrdfglryrpelplavqgvsfkihagekvgivgrtgagksslasgllrlqeaaeg
giwidgvpiahvglhtlrsrisiipqdpilfpgslrmnldllqehsdeaiwaaletvqlk
alvaslpgqlqykcadrgedlsvgqkqllclarallrktqilildeataavdpgtelqmq
amlgswfaqctvlliahrlrsvmdcarvlvmdkgqvaesgspaqllaqkglfyrlaqesg
lv

Sequence, based on observed residues (ATOM records): (download)

>d6bzrb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggqiefrdfglryrpelplavqgvsfkihagekvgivgrtgagksslasgllrlqeaaeg
giwidgvpiahvglhtlrsrisiipqdpilfpgslrmnldllqehsdeaiwaaletvqlk
alvaslpgqlqykcdlsvgqkqllclarallrktqilildeataavdpgtelqmqamlgs
wfaqctvlliahrlrsvmdcarvlvmdkgqvaesgspaqllaqkglfyrlaqesglv

SCOPe Domain Coordinates for d6bzrb_ are not available.

Timeline for d6bzrb_:

Domains from other chains:
(mouse over for more information)
d6bzra_