SCOPe 2.08: Domain d6d7ge2: 6d7g E:120-226

Lineage for d6d7ge2 (6d7g E:120-226)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6d7ge2: 6d7g E:120-226 [362670]
   Other proteins in same PDB: d6d7gd1, d6d7gd2, d6d7ge1
   automated match to d4lfhg2
   complexed with nag

Details for d6d7ge2

PDB Entry: 6d7g, 2.75 Å

PDB Description: structure of 5f3 tcr in complex with hla-a2/mart-1

PDB Compounds: (E:) T-cell receptor gamma variable 8,T-cell receptor gamma-2 chain c region

SCOPe Domain Sequences for d6d7ge2:

Sequence, based on SEQRES records:

>d6d7ge2 b.1.1.2 (E:120-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqldadvspkptiflpsiaetklqkagtylcllekffpdiikihwqekksntilgsqegn
tmktndtymkfswltvpeesldkehrcivrhennkngidqeiifppi

Sequence, based on observed residues (ATOM records):

>d6d7ge2 b.1.1.2 (E:120-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kqladvspkptiflpsiaetklqkagtylcllekffpdiikihwqegsqegntmktndty
mkfswltvesldkehrcivrhenngidqeiifppi

Timeline for d6d7ge2:

• d6d7ge2 first appeared in SCOPe 2.07