SCOPe 2.07: Domain d6czoc1: 6czo C:7-298

Lineage for d6czoc1 (6czo C:7-298)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (6 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (17 PDB entries)
   Uniprot P37140 1-308

8. Domain d6czoc1: 6czo C:7-298 [362666]
   Other proteins in same PDB: d6czoa2, d6czoc2
   automated match to d1s70a_
   complexed with mn, po4

Details for d6czoc1

PDB Entry: 6czo, 2.95 Å

PDB Description: the knl1-pp1 holoenzyme

PDB Compounds: (C:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d6czoc1:

Sequence; same for both SEQRES and ATOM records:

>d6czoc1 d.159.1.3 (C:7-298) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp

Timeline for d6czoc1:

• d6czoc1 is new in SCOPe 2.07-stable
  
• d6czoc1 appears in the current release, SCOPe 2.08