Lineage for d6czoa1 (6czo A:7-298)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556189Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2556190Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2556269Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2556295Protein Protein phosphatase-1 (PP-1) [56311] (6 species)
  7. 2556317Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (17 PDB entries)
    Uniprot P37140 1-308
  8. 3062598Domain d6czoa1: 6czo A:7-298 [362660]
    Other proteins in same PDB: d6czoa2, d6czoc2
    automated match to d1s70a_
    complexed with mn, po4

Details for d6czoa1

PDB Entry: 6czo (more details), 2.95 Å

PDB Description: the knl1-pp1 holoenzyme
PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d6czoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6czoa1 d.159.1.3 (A:7-298) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp

SCOPe Domain Coordinates for d6czoa1:

Click to download the PDB-style file with coordinates for d6czoa1.
(The format of our PDB-style files is described here.)

Timeline for d6czoa1:

  • d6czoa1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6czoa2