Lineage for d6crnc_ (6crn C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2497139Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2497140Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2498051Family d.3.1.0: automated matches [191342] (1 protein)
    not a true family
  6. 2498052Protein automated matches [190230] (21 species)
    not a true protein
  7. 2498073Species Human (Homo sapiens) [TaxId:9606] [187072] (48 PDB entries)
  8. 3062590Domain d6crnc_: 6crn C: [362652]
    Other proteins in same PDB: d6crna2, d6crnd2, d6crne_, d6crnf_, d6crng_, d6crnh_
    automated match to d2hd5a1
    complexed with zn

Details for d6crnc_

PDB Entry: 6crn (more details), 2.5 Å

PDB Description: structure of the usp15 deubiquitinase domain in complex with a high- affinity first-generation ubv
PDB Compounds: (C:) ubiquitin carboxyl-terminal hydrolase 15

SCOPe Domain Sequences for d6crnc_:

Sequence, based on SEQRES records: (download)

>d6crnc_ d.3.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrg
eiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqqqdcqellaflldglhedl
nrirkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisv
tfdpfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqatkkldlws
lppvlvvhlkrfsysrymrdkldtlvdfpindldmseflinpnagpcrynliavsnhygg
mggghytafaknkddgkwyyfddssvstasedqivskaayvlfyqrq

Sequence, based on observed residues (ATOM records): (download)

>d6crnc_ d.3.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sepgrnneqpglcglsnlgntcfmnsaiqclsntpplteyflndkyqeelnfdnplgmrg
eiaksyaelikqmwsgkfsyvtprafktqvgrfapqfsgyqcqellaflldglhedlnri
rkkpyiqlkdadgrpdkvvaeeawenhlkrndsiivdifhglfkstlvcpecakisvtfd
pfcyltlplpmpkkpfvklkdcielfttkeklgaedpwycpnckehqqatkkldlwslpp
vlvvhlkrfkldtlvdfpindldmseflinpnagpcrynliavsnhygggghytafaknk
ddgkwyyfddssvstasedqivskaayvlfyqrq

SCOPe Domain Coordinates for d6crnc_:

Click to download the PDB-style file with coordinates for d6crnc_.
(The format of our PDB-style files is described here.)

Timeline for d6crnc_:

  • d6crnc_ appears in periodic updates to SCOPe 2.07 starting on 2019-01-24