Lineage for d5zwtb1 (5zwt B:3-80)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. Protein automated matches [191038] (28 species)
    not a true protein
  7. Species Leishmania major [TaxId:5664] [259666] (3 PDB entries)
  8. Domain d5zwtb1: 5zwt B:3-80 [362621]
    Other proteins in same PDB: d5zwta2, d5zwtb2
    automated match to d2lola_
    mutant

Details for d5zwtb1

PDB Entry: 5zwt (more details), 2 Å

PDB Description: crystal structure of the s37a mutant of apo-acyl carrier protein from leishmania major
PDB Compounds: (B:) Acyl carrier protein

SCOPe Domain Sequences for d5zwtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zwtb1 a.28.1.0 (B:3-80) automated matches {Leishmania major [TaxId: 5664]}
dvltrvlevvknfekvdaskvtpeshfvkdlglnaldvvevvfaieqefildipdhdaek
iqsipdaveyiaqnpmak

SCOPe Domain Coordinates for d5zwtb1 are not available.

Timeline for d5zwtb1:

Domains from same chain:
(mouse over for more information)
d5zwtb2
Domains from other chains:
(mouse over for more information)
d5zwta1, d5zwta2