SCOPe 2.08: Domain d5ywkb2: 5ywk B:233-434

Lineage for d5ywkb2 (5ywk B:233-434)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (16 PDB entries)
   Uniprot P93836 33-428 ! Uniprot P93836 63-459

8. Domain d5ywkb2: 5ywk B:233-434 [362608]
   automated match to d1sp9a2
   complexed with 92x, co

Details for d5ywkb2

PDB Entry: 5ywk, 2.8 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with benquitrione-methyl

PDB Compounds: (B:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5ywkb2:

Sequence, based on SEQRES records:

>d5ywkb2 d.32.1.3 (B:233-434) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrks
qiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgd
vlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayq
sggcggfgkgnfselfksieey

Sequence, based on observed residues (ATOM records):

>d5ywkb2 d.32.1.3 (B:233-434) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaefsglnsavlasndemvllpinepvksqiqtylehnegagl
qhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikeceelg
ilvdrddqgtllqiftkplgdrptifieiiqrvgcmmyqsggcggfgkgnfselfksiee
y

Timeline for d5ywkb2:

• d5ywkb2 first appeared in SCOPe 2.07