Lineage for d5zfmd_ (5zfm D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455806Species Lactobacillus brevis [TaxId:387344] [362524] (2 PDB entries)
  8. 2455810Domain d5zfmd_: 5zfm D: [362605]
    automated match to d4rf5a_
    mutant

Details for d5zfmd_

PDB Entry: 5zfm (more details), 2 Å

PDB Description: ketoreductase lbcr mutant - m6
PDB Compounds: (D:) 3-oxoacyl-acyl carrier protein reductase

SCOPe Domain Sequences for d5zfmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zfmd_ c.2.1.0 (D:) automated matches {Lactobacillus brevis [TaxId: 387344]}
tdrlkdkvaiitggvagiglgiaecyvregakvvvtanhnvdggraavakfgddvslfvq
qdvskeadwqkvidatiakfgrvdilvnnagiggvntaiedldladwqkvidvnltanfl
gekaaikamkqtadakgsiinvssvaglvglpidpaysaskggsrllthatalnlaqrgi
dirvnsvhpgwidtsivpedlrkqiiatipvghmgqpqdigevcvylgsdesrfangaef
tvdggqra

SCOPe Domain Coordinates for d5zfmd_:

Click to download the PDB-style file with coordinates for d5zfmd_.
(The format of our PDB-style files is described here.)

Timeline for d5zfmd_: