Class a: All alpha proteins [46456] (290 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) |
Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
Protein automated matches [191038] (29 species) not a true protein |
Species Leishmania major [TaxId:5664] [259666] (3 PDB entries) |
Domain d5zwsb1: 5zws B:3-80 [362594] Other proteins in same PDB: d5zwsa2, d5zwsb2 automated match to d2lola_ |
PDB Entry: 5zws (more details), 2 Å
SCOPe Domain Sequences for d5zwsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zwsb1 a.28.1.0 (B:3-80) automated matches {Leishmania major [TaxId: 5664]} dvltrvlevvknfekvdaskvtpeshfvkdlglnsldvvevvfaieqefildipdhdaek iqsipdaveyiaqnpmak
Timeline for d5zwsb1: