SCOPe 2.08: Domain d5zwsb1: 5zws B:3-80

Lineage for d5zwsb1 (5zws B:3-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (29 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [259666] (3 PDB entries)

8. Domain d5zwsb1: 5zws B:3-80 [362594]
   Other proteins in same PDB: d5zwsa2, d5zwsb2
   automated match to d2lola_

Details for d5zwsb1

PDB Entry: 5zws, 2 Å

PDB Description: crystal structure of apo-acyl carrier protein from leishmania major

PDB Compounds: (B:) Acyl carrier protein

SCOPe Domain Sequences for d5zwsb1:

Sequence; same for both SEQRES and ATOM records:

>d5zwsb1 a.28.1.0 (B:3-80) automated matches {Leishmania major [TaxId: 5664]}
dvltrvlevvknfekvdaskvtpeshfvkdlglnsldvvevvfaieqefildipdhdaek
iqsipdaveyiaqnpmak

Timeline for d5zwsb1:

• d5zwsb1 first appeared in SCOPe 2.07