Lineage for d5ywgb1 (5ywg B:29-232)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (14 PDB entries)
    Uniprot P93836 33-428 ! Uniprot P93836 63-459
  8. Domain d5ywgb1: 5ywg B:29-232 [362582]
    automated match to d1sp9a1
    complexed with 92l, co

Details for d5ywgb1

PDB Entry: 5ywg (more details), 2.6 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with mesotrione
PDB Compounds: (B:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5ywgb1:

Sequence, based on SEQRES records: (download)

>d5ywgb1 d.32.1.3 (B:29-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasy
lltsgdlrflftapyspslsageikptttasipsfdhgscrsffsshglgvravaieved
aesafsisvangaipssppivlneavtiaevklygdvvlryvsykaedtekseflpgfer
vedassfpldygirrldhavgnvp

Sequence, based on observed residues (ATOM records): (download)

>d5ywgb1 d.32.1.3 (B:29-232) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
fskfvrknpksdkfkvkrfhhiefwcgdatnvarrfswglgmrfsaksdlstgnmvhasy
lltsgdlrflftapyspsltasipsfdhgscrsffsshglgvravaievedaesafsisv
angaipssppivlneavtiaevklygdvvlryvsykaflpgfervdassfpldygirrld
havgnvp

SCOPe Domain Coordinates for d5ywgb1 are not available.

Timeline for d5ywgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ywgb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ywga1, d5ywga2