Lineage for d5zwsa1 (5zws A:3-80)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706293Species Leishmania major [TaxId:5664] [259666] (3 PDB entries)
  8. 2706294Domain d5zwsa1: 5zws A:3-80 [362573]
    Other proteins in same PDB: d5zwsa2, d5zwsb2
    automated match to d2lola_

Details for d5zwsa1

PDB Entry: 5zws (more details), 2 Å

PDB Description: crystal structure of apo-acyl carrier protein from leishmania major
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d5zwsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zwsa1 a.28.1.0 (A:3-80) automated matches {Leishmania major [TaxId: 5664]}
dvltrvlevvknfekvdaskvtpeshfvkdlglnsldvvevvfaieqefildipdhdaek
iqsipdaveyiaqnpmak

SCOPe Domain Coordinates for d5zwsa1:

Click to download the PDB-style file with coordinates for d5zwsa1.
(The format of our PDB-style files is described here.)

Timeline for d5zwsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zwsa2