Lineage for d5zg0b_ (5zg0 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2520988Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2522032Protein automated matches [190140] (38 species)
    not a true protein
  7. 2522155Species Human (Homo sapiens) [TaxId:9606] [189406] (19 PDB entries)
  8. 2522176Domain d5zg0b_: 5zg0 B: [362572]
    Other proteins in same PDB: d5zg0d2
    automated match to d2xhda_
    complexed with 9c3, act, glu, zn

Details for d5zg0b_

PDB Entry: 5zg0 (more details), 1.58 Å

PDB Description: crystal structure of the glua2o lbd in complex with glutamate and compound-1
PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d5zg0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zg0b_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
eqglldklknkwwydkgecg

SCOPe Domain Coordinates for d5zg0b_:

Click to download the PDB-style file with coordinates for d5zg0b_.
(The format of our PDB-style files is described here.)

Timeline for d5zg0b_: