Lineage for d5zg3f_ (5zg3 F:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. Protein automated matches [190140] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189406] (17 PDB entries)
  8. Domain d5zg3f_: 5zg3 F: [362571]
    Other proteins in same PDB: d5zg3d2
    automated match to d2xhda_
    complexed with 9c6, act, glu, zn

Details for d5zg3f_

PDB Entry: 5zg3 (more details), 1.6500000000000001 Å

PDB Description: crystal structure of the glua2o lbd in complex with glutamate and tak- 137
PDB Compounds: (F:) Glutamate receptor 2

SCOPe Domain Sequences for d5zg3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zg3f_ c.94.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslrnavnlavlkln
eqglldklknkwwydkgecg

SCOPe Domain Coordinates for d5zg3f_ are not available.

Timeline for d5zg3f_:

Domains from other chains:
(mouse over for more information)
d5zg3a_, d5zg3b_, d5zg3c_, d5zg3d1, d5zg3d2, d5zg3e_