SCOPe 2.08: Domain d6n9gc_: 6n9g C:

Lineage for d6n9gc_ (6n9g C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188331] (2 PDB entries)

8. Domain d6n9gc_: 6n9g C: [362470]
   automated match to d2pbib_

Details for d6n9gc_

PDB Entry: 6n9g, 2.13 Å

PDB Description: crystal structure of rgs7-gbeta5 dimer

PDB Compounds: (C:) Guanine nucleotide-binding protein subunit beta-5

SCOPe Domain Sequences for d6n9gc_:

Sequence; same for both SEQRES and ATOM records:

>d6n9gc_ b.69.4.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tdglhenetlaslkseaeslkgkleeeraklhdvelhqvaervealgqfvmktrrtlkgh
gnkvlcmdwckdkrrivsssqdgkvivwdsfttnkehavtmpctwvmacayapsgcaiac
ggldnkcsvypltfdknenmaakkksvamhtnylsacsftnsdmqiltasgdgtcalwdv
esgqllqsfhghgadvlcldlapsetgntfvsggcdkkamvwdmrsgqcvqafethesdv
nsvryypsgdafasgsddatcrlydlradrevaiyskesiifgassvdfslsgrllfagy
ndytinvwdvlkgsrvsilfghenrvstlrvspdgtafcsgswdhtlrvwa

Timeline for d6n9gc_:

• d6n9gc_ first appeared in SCOPe 2.07