Lineage for d1cnsa_ (1cns A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 850027Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 850028Superfamily d.2.1: Lysozyme-like [53955] (11 families) (S)
  5. 850029Family d.2.1.1: Family 19 glycosidase [53956] (1 protein)
  6. 850030Protein Plant class II chitinase [53957] (2 species)
  7. 850031Species Barley (Hordeum vulgare) [TaxId:4513] [53958] (2 PDB entries)
  8. 850033Domain d1cnsa_: 1cns A: [36241]

Details for d1cnsa_

PDB Entry: 1cns (more details), 1.91 Å

PDB Description: crystal structure of chitinase at 1.91a resolution
PDB Compounds: (A:) chitinase

SCOP Domain Sequences for d1cnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnsa_ d.2.1.1 (A:) Plant class II chitinase {Barley (Hordeum vulgare) [TaxId: 4513]}
svssivsraqfdrmllhrndgacqakgfytydafvaaaaafsgfgttgsadvqkrevaaf
laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
hnynygpagraigvdllanpdlvatdatvsfktamwfwmtaqppkpsshavivgqwspsg
adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
pfa

SCOP Domain Coordinates for d1cnsa_:

Click to download the PDB-style file with coordinates for d1cnsa_.
(The format of our PDB-style files is described here.)

Timeline for d1cnsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cnsb_