Lineage for d1de3a_ (1de3 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 75820Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 75821Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 75822Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 75921Protein Ribotoxin [53951] (2 species)
  7. 75922Species Fungus (Aspergillus giganteus), alpha-Sarcin [53953] (1 PDB entry)
  8. 75923Domain d1de3a_: 1de3 A: [36240]

Details for d1de3a_

PDB Entry: 1de3 (more details)

PDB Description: solution structure of the cytotoxic ribonuclease alpha-sarcin

SCOP Domain Sequences for d1de3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de3a_ d.1.1.1 (A:) Ribotoxin {Fungus (Aspergillus giganteus), alpha-Sarcin}
avtwtclndqknpktnkyetkrllynqnkaesnshhaplsdgktgssyphwftngydgdg
klpkgrtpikfgksdcdrppkhskdgngktdhyllefptfpdghdykfdskkpkenpgpa
rviytypnkvfcgiiahtkenqgelklcsh

SCOP Domain Coordinates for d1de3a_:

Click to download the PDB-style file with coordinates for d1de3a_.
(The format of our PDB-style files is described here.)

Timeline for d1de3a_: