Lineage for d1de3a_ (1de3 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2494618Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2494619Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2494846Family d.1.1.3: Ribotoxin [81310] (2 protein domains)
    the fungal cytotoxic ribonucleases with many insertions in the common fold
  6. 2494847Protein alpha-Sarcin [81309] (1 species)
  7. 2494848Species Fungus (Aspergillus giganteus) [TaxId:5060] [53953] (2 PDB entries)
  8. 2494849Domain d1de3a_: 1de3 A: [36240]

Details for d1de3a_

PDB Entry: 1de3 (more details)

PDB Description: solution structure of the cytotoxic ribonuclease alpha-sarcin
PDB Compounds: (A:) ribonuclease alpha-sarcin

SCOPe Domain Sequences for d1de3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de3a_ d.1.1.3 (A:) alpha-Sarcin {Fungus (Aspergillus giganteus) [TaxId: 5060]}
avtwtclndqknpktnkyetkrllynqnkaesnshhaplsdgktgssyphwftngydgdg
klpkgrtpikfgksdcdrppkhskdgngktdhyllefptfpdghdykfdskkpkenpgpa
rviytypnkvfcgiiahtkenqgelklcsh

SCOPe Domain Coordinates for d1de3a_:

Click to download the PDB-style file with coordinates for d1de3a_.
(The format of our PDB-style files is described here.)

Timeline for d1de3a_: