Lineage for d1aqzb_ (1aqz B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2531194Family d.1.1.3: Ribotoxin [81310] (2 proteins)
    the fungal cytotoxic ribonucleases with many insertions in the common fold
  6. 2531199Protein Restrictocin [81308] (1 species)
  7. 2531200Species Fungus (Aspergillus restrictus) [TaxId:5064] [53952] (4 PDB entries)
  8. 2531202Domain d1aqzb_: 1aqz B: [36239]
    complexed with po4

Details for d1aqzb_

PDB Entry: 1aqz (more details), 1.7 Å

PDB Description: crystal structure of a highly specific aspergillus ribotoxin, restrictocin
PDB Compounds: (B:) restrictocin

SCOPe Domain Sequences for d1aqzb_:

Sequence, based on SEQRES records: (download)

>d1aqzb_ d.1.1.3 (B:) Restrictocin {Fungus (Aspergillus restrictus) [TaxId: 5064]}
atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgpar
viytypnkvfcgivahqrgnqgdlrlcsh

Sequence, based on observed residues (ATOM records): (download)

>d1aqzb_ d.1.1.3 (B:) Restrictocin {Fungus (Aspergillus restrictus) [TaxId: 5064]}
atwtcinqqlwedkrllysqakaesnshhaplsdgktgssyphwftngydgngklikgrt
pikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgparviytyp
nkvfcgivahqrgnqgdlrlcsh

SCOPe Domain Coordinates for d1aqzb_:

Click to download the PDB-style file with coordinates for d1aqzb_.
(The format of our PDB-style files is described here.)

Timeline for d1aqzb_: