SCOPe 2.06: Domain d1aqza_: 1aqz A:

Lineage for d1aqza_ (1aqz A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.3: Ribotoxin [81310] (2 proteins)
   the fungal cytotoxic ribonucleases with many insertions in the common fold

6. Protein Restrictocin [81308] (1 species)

7. Species Fungus (Aspergillus restrictus) [TaxId:5064] [53952] (4 PDB entries)

8. Domain d1aqza_: 1aqz A: [36238]
   complexed with po4

Details for d1aqza_

PDB Entry: 1aqz, 1.7 Å

PDB Description: crystal structure of a highly specific aspergillus ribotoxin, restrictocin

PDB Compounds: (A:) restrictocin

SCOPe Domain Sequences for d1aqza_:

Sequence, based on SEQRES records:

>d1aqza_ d.1.1.3 (A:) Restrictocin {Fungus (Aspergillus restrictus) [TaxId: 5064]}
atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgpar
viytypnkvfcgivahqrgnqgdlrlcsh

Sequence, based on observed residues (ATOM records):

>d1aqza_ d.1.1.3 (A:) Restrictocin {Fungus (Aspergillus restrictus) [TaxId: 5064]}
atwtcinqqledkrllysqakaesnshhaplsdgktgssyphwftngydgngklikgrtp
ikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgparviytypn
kvfcgivahqrgnqgdlrlcsh

Timeline for d1aqza_:

• d1aqza_ first appeared (with stable ids) in SCOP 1.55
  
• d1aqza_ appears in SCOPe 2.05
  
• d1aqza_ appears in SCOPe 2.07
  
• d1aqza_ appears in the current release, SCOPe 2.08