Lineage for d1aqza_ (1aqz A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 28524Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 28525Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 28526Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 28625Protein Ribotoxin [53951] (2 species)
  7. 28628Species Fungus (Aspergillus restrictus), restrictocin [53952] (1 PDB entry)
  8. 28629Domain d1aqza_: 1aqz A: [36238]

Details for d1aqza_

PDB Entry: 1aqz (more details), 1.7 Å

PDB Description: crystal structure of a highly specific aspergillus ribotoxin, restrictocin

SCOP Domain Sequences for d1aqza_:

Sequence, based on SEQRES records: (download)

>d1aqza_ d.1.1.1 (A:) Ribotoxin {Fungus (Aspergillus restrictus), restrictocin}
atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgpar
viytypnkvfcgivahqrgnqgdlrlcsh

Sequence, based on observed residues (ATOM records): (download)

>d1aqza_ d.1.1.1 (A:) Ribotoxin {Fungus (Aspergillus restrictus), restrictocin}
atwtcinqqledkrllysqakaesnshhaplsdgktgssyphwftngydgngklikgrtp
ikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgparviytypn
kvfcgivahqrgnqgdlrlcsh

SCOP Domain Coordinates for d1aqza_:

Click to download the PDB-style file with coordinates for d1aqza_.
(The format of our PDB-style files is described here.)

Timeline for d1aqza_: