![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.3: Ribotoxin [81310] (2 proteins) the fungal cytotoxic ribonucleases with many insertions in the common fold |
![]() | Protein Restrictocin [81308] (1 species) |
![]() | Species Fungus (Aspergillus restrictus) [TaxId:5064] [53952] (4 PDB entries) |
![]() | Domain d1aqza_: 1aqz A: [36238] complexed with po4 |
PDB Entry: 1aqz (more details), 1.7 Å
SCOPe Domain Sequences for d1aqza_:
Sequence, based on SEQRES records: (download)
>d1aqza_ d.1.1.3 (A:) Restrictocin {Fungus (Aspergillus restrictus) [TaxId: 5064]} atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgpar viytypnkvfcgivahqrgnqgdlrlcsh
>d1aqza_ d.1.1.3 (A:) Restrictocin {Fungus (Aspergillus restrictus) [TaxId: 5064]} atwtcinqqledkrllysqakaesnshhaplsdgktgssyphwftngydgngklikgrtp ikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgparviytypn kvfcgivahqrgnqgdlrlcsh
Timeline for d1aqza_: