Lineage for d1aqza_ (1aqz A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. Family d.1.1.3: Ribotoxin [81310] (2 proteins)
    the fungal cytotoxic ribonucleases with many insertions in the common fold
  6. Protein Restrictocin [81308] (1 species)
  7. Species Fungus (Aspergillus restrictus) [TaxId:5064] [53952] (4 PDB entries)
  8. Domain d1aqza_: 1aqz A: [36238]
    complexed with po4

Details for d1aqza_

PDB Entry: 1aqz (more details), 1.7 Å

PDB Description: crystal structure of a highly specific aspergillus ribotoxin, restrictocin
PDB Compounds: (A:) restrictocin

SCOPe Domain Sequences for d1aqza_:

Sequence, based on SEQRES records: (download)

>d1aqza_ d.1.1.3 (A:) Restrictocin {Fungus (Aspergillus restrictus) [TaxId: 5064]}
atwtcinqqlnpktnkwedkrllysqakaesnshhaplsdgktgssyphwftngydgngk
likgrtpikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgpar
viytypnkvfcgivahqrgnqgdlrlcsh

Sequence, based on observed residues (ATOM records): (download)

>d1aqza_ d.1.1.3 (A:) Restrictocin {Fungus (Aspergillus restrictus) [TaxId: 5064]}
atwtcinqqledkrllysqakaesnshhaplsdgktgssyphwftngydgngklikgrtp
ikfgkadcdrppkhsqngmgkddhyllefptfpdghdykfdskkpkenpgparviytypn
kvfcgivahqrgnqgdlrlcsh

SCOPe Domain Coordinates for d1aqza_ are not available.

Timeline for d1aqza_:

Domains from other chains:
(mouse over for more information)
d1aqzb_