Lineage for d1rmsa_ (1rms A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2494618Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2494619Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2494861Family d.1.1.4: Fungal ribonucleases [81311] (4 protein domains)
  6. 2494868Protein RNase Ms [53947] (1 species)
  7. 2494869Species Molsin (Aspergillus saitoi) [TaxId:5063] [53948] (2 PDB entries)
  8. 2494871Domain d1rmsa_: 1rms A: [36235]
    complexed with 3gp

Details for d1rmsa_

PDB Entry: 1rms (more details), 1.9 Å

PDB Description: crystal structures of ribonuclease ms complexed with 3'-guanylic acid a gp*c analogue, 2'-deoxy-2'-fluoroguanylyl-3',5'-cytidine
PDB Compounds: (A:) ribonuclease ms

SCOPe Domain Sequences for d1rmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmsa_ d.1.1.4 (A:) RNase Ms {Molsin (Aspergillus saitoi) [TaxId: 5063]}
esceytcgstcywssdvsaakakgyslyesgdtiddypheyhdyegfdfpvsgtyyeypi
msdydvytggspgadrvifngddelagvithtgasgddfvacsss

SCOPe Domain Coordinates for d1rmsa_:

Click to download the PDB-style file with coordinates for d1rmsa_.
(The format of our PDB-style files is described here.)

Timeline for d1rmsa_: