SCOPe 2.05: Domain d1buja_: 1buj A:

Lineage for d1buja_ (1buj A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Binase [81306] (1 species)

7. Species Bacillus intermedius [TaxId:1400] [53946] (5 PDB entries)

8. Domain d1buja_: 1buj A: [36234]

Details for d1buja_

PDB Entry: 1buj

PDB Description: structure of binase in solution

PDB Compounds: (A:) protein (binase)

SCOPe Domain Sequences for d1buja_:

Sequence; same for both SEQRES and ATOM records:

>d1buja_ d.1.1.2 (A:) Binase {Bacillus intermedius [TaxId: 1400]}
avintfdgvadylirykrlpdnyitksqasalgwvaskgnlaevapgksiggdvfsnreg
rlpsasgrtwreadinyvsgfrnadrlvyssdwliykttdhyatftrir

Timeline for d1buja_:

• d1buja_ first appeared (with stable ids) in SCOP 1.55
  
• d1buja_ appears in SCOPe 2.04
  
• d1buja_ appears in SCOPe 2.06
  
• d1buja_ appears in the current release, SCOPe 2.08