Lineage for d2rbia_ (2rbi A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2494618Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2494619Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2494620Family d.1.1.2: Bacterial ribonucleases [81307] (6 protein domains)
  6. 2494751Protein Binase [81306] (1 species)
  7. 2494752Species Bacillus intermedius [TaxId:1400] [53946] (5 PDB entries)
  8. 2494757Domain d2rbia_: 2rbi A: [36232]
    mutant

Details for d2rbia_

PDB Entry: 2rbi (more details), 2.2 Å

PDB Description: structure of binase mutant his 101 asn
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d2rbia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rbia_ d.1.1.2 (A:) Binase {Bacillus intermedius [TaxId: 1400]}
vintfdgvadylirykrlpdnyitksqasalgwvaskgnlaevapgksiggdvfsnregr
lpsasgrtwreadinyvsgfrnadrlvyssdwliykttdnyatftrir

SCOPe Domain Coordinates for d2rbia_:

Click to download the PDB-style file with coordinates for d2rbia_.
(The format of our PDB-style files is described here.)

Timeline for d2rbia_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2rbib_