![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
![]() | Protein Barnase [81305] (1 species) |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries) |
![]() | Domain d1b3sc_: 1b3s C: [36231] Other proteins in same PDB: d1b3sd_, d1b3se_, d1b3sf_ protein/RNA complex; mutant |
PDB Entry: 1b3s (more details), 2.39 Å
SCOPe Domain Sequences for d1b3sc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b3sc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]} vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir
Timeline for d1b3sc_: