SCOPe 2.07: Domain d6mj4d1: 6mj4 D:2-112

Lineage for d6mj4d1 (6mj4 D:2-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6mj4d1: 6mj4 D:2-112 [362303]
   Other proteins in same PDB: d6mj4a1, d6mj4b_, d6mj4c2
   automated match to d3q5ya1
   protein/RNA complex; complexed with fuc, gol, jtg, na, nag

Details for d6mj4d1

PDB Entry: 6mj4, 2 Å

PDB Description: crystal structure of mcd1d/inktcr ternary complex bound to glycolipid (xxw)

PDB Compounds: (D:) Beta-chain,T cell receptor chain,T cell receptor beta constant 2, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mj4d1:

Sequence; same for both SEQRES and ATOM records:

>d6mj4d1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

Timeline for d6mj4d1:

• d6mj4d1 is new in SCOPe 2.07-stable
  
• d6mj4d1 appears in the current release, SCOPe 2.08