Lineage for d6mjqc2 (6mjq C:116-204)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749711Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)
  8. 2749751Domain d6mjqc2: 6mjq C:116-204 [362301]
    Other proteins in same PDB: d6mjqa1, d6mjqa2, d6mjqb_, d6mjqc1, d6mjqd1, d6mjqd2, d6mjqe1, d6mjqe2, d6mjqf_, d6mjqg1, d6mjqh1, d6mjqh2
    automated match to d2pyfa2
    complexed with gol, jud, na, nag

Details for d6mjqc2

PDB Entry: 6mjq (more details), 3 Å

PDB Description: crystal structure of the mcd1d/xxp (jj295) /inktcr ternary complex
PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mjqc2:

Sequence, based on SEQRES records: (download)

>d6mjqc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d6mjqc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnfacanafnnsiipedtffps

SCOPe Domain Coordinates for d6mjqc2:

Click to download the PDB-style file with coordinates for d6mjqc2.
(The format of our PDB-style files is described here.)

Timeline for d6mjqc2: