Lineage for d1b3sb_ (1b3s B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2530966Protein Barnase [81305] (1 species)
  7. 2530967Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. 2531073Domain d1b3sb_: 1b3s B: [36230]
    Other proteins in same PDB: d1b3sd_, d1b3se_, d1b3sf_
    protein/RNA complex; mutant

Details for d1b3sb_

PDB Entry: 1b3s (more details), 2.39 Å

PDB Description: structural response to mutation at a protein-protein interface
PDB Compounds: (B:) protein (barnase)

SCOPe Domain Sequences for d1b3sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3sb_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
aqvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkir

SCOPe Domain Coordinates for d1b3sb_:

Click to download the PDB-style file with coordinates for d1b3sb_.
(The format of our PDB-style files is described here.)

Timeline for d1b3sb_: