Lineage for d6msca1 (6msc A:449-769)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349642Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2349643Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2350180Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2350181Protein automated matches [190983] (10 species)
    not a true protein
  7. 2350200Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)
  8. 2350469Domain d6msca1: 6msc A:449-769 [362289]
    Other proteins in same PDB: d6msca2, d6mscb2
    automated match to d4ajmd_
    complexed with jy7, mg, zn

Details for d6msca1

PDB Entry: 6msc (more details), 2.36 Å

PDB Description: novel, potent, selective and brain penetrant phosphodiesterase 10a inhibitors
PDB Compounds: (A:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d6msca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6msca1 a.211.1.0 (A:449-769) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sictseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfelekl
crfimsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhr
gfsnsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirk
aiiatdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtklt
andiyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilppt
epllkacrdnlsqwekvirge

SCOPe Domain Coordinates for d6msca1:

Click to download the PDB-style file with coordinates for d6msca1.
(The format of our PDB-style files is described here.)

Timeline for d6msca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6msca2