Lineage for d6mjqh1 (6mjq H:2-112)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2369283Domain d6mjqh1: 6mjq H:2-112 [362269]
    Other proteins in same PDB: d6mjqa1, d6mjqb_, d6mjqc2, d6mjqe1, d6mjqf_, d6mjqg2
    automated match to d3q5ya1
    complexed with bma, fuc, gol, jud, man, na, nag

Details for d6mjqh1

PDB Entry: 6mjq (more details), 3 Å

PDB Description: crystal structure of the mcd1d/xxp (jj295) /inktcr ternary complex
PDB Compounds: (H:) Beta-chain,T cell receptor chain,T cell receptor beta constant 2, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mjqh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjqh1 b.1.1.0 (H:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d6mjqh1:

Click to download the PDB-style file with coordinates for d6mjqh1.
(The format of our PDB-style files is described here.)

Timeline for d6mjqh1: