SCOPe 2.08: Domain d6mj4c1: 6mj4 C:1-115

Lineage for d6mj4c1 (6mj4 C:1-115)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6mj4c1: 6mj4 C:1-115 [362255]
   Other proteins in same PDB: d6mj4a1, d6mj4b_, d6mj4c2
   automated match to d2pyfa1
   protein/RNA complex; complexed with gol, jtg, na, nag

Details for d6mj4c1

PDB Entry: 6mj4, 2 Å

PDB Description: crystal structure of mcd1d/inktcr ternary complex bound to glycolipid (xxw)

PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mj4c1:

Sequence; same for both SEQRES and ATOM records:

>d6mj4c1 b.1.1.0 (C:1-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsng
rysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d6mj4c1:

• d6mj4c1 first appeared in SCOPe 2.07