Lineage for d6mjjc1 (6mjj C:1-115)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2754837Domain d6mjjc1: 6mjj C:1-115 [362253]
    Other proteins in same PDB: d6mjja1, d6mjjb_, d6mjjc2
    automated match to d2pyfa1
    complexed with gol, ju4, na, nag

Details for d6mjjc1

PDB Entry: 6mjj (more details), 1.93 Å

PDB Description: crystal structure of the mcd1d/xxm (jj290) /inktcr ternary complex
PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6mjjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjjc1 b.1.1.0 (C:1-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsng
rysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d6mjjc1:

Click to download the PDB-style file with coordinates for d6mjjc1.
(The format of our PDB-style files is described here.)

Timeline for d6mjjc1: