SCOPe 2.08: Domain d6miyc2: 6miy C:116-204

Lineage for d6miyc2 (6miy C:116-204)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)

8. Domain d6miyc2: 6miy C:116-204 [362236]
   Other proteins in same PDB: d6miya1, d6miya2, d6miyb_, d6miyc1, d6miyd1, d6miyd2, d6miye1, d6miye2, d6miyf_, d6miyg1, d6miyh1, d6miyh2
   automated match to d2pyfa2
   complexed with cl, gol, jtv, na

Details for d6miyc2

PDB Entry: 6miy, 2.75 Å

PDB Description: crystal structure of the mcd1d/xxa (jj239)/inktcr ternary complex

PDB Compounds: (C:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6miyc2:

Sequence, based on SEQRES records:

>d6miyc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d6miyc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnfacanafnnsiipedtffps

Timeline for d6miyc2:

• d6miyc2 first appeared in SCOPe 2.07