Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries) |
Domain d6miyc2: 6miy C:116-204 [362236] Other proteins in same PDB: d6miya1, d6miya2, d6miyb_, d6miyc1, d6miyd1, d6miyd2, d6miye1, d6miye2, d6miyf_, d6miyg1, d6miyh1, d6miyh2 automated match to d2pyfa2 complexed with cl, gol, jtv, na |
PDB Entry: 6miy (more details), 2.75 Å
SCOPe Domain Sequences for d6miyc2:
Sequence, based on SEQRES records: (download)
>d6miyc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d6miyc2 b.1.1.2 (C:116-204) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnfacanafnnsiipedtffps
Timeline for d6miyc2: