Lineage for d6gvja2 (6gvj A:754-795)

  1. Root: SCOPe 2.08
  2. Class l: Artifacts [310555] (1 fold)
  3. Fold l.1: Tags [310573] (1 superfamily)
  4. Superfamily l.1.1: Tags [310607] (1 family) (S)
  5. Family l.1.1.1: Tags [310682] (2 proteins)
  6. Protein C-terminal Tags [310895] (1 species)
  7. Species Synthetic [311502] (5964 PDB entries)
  8. Domain d6gvja2: 6gvj A:754-795 [362234]
    Other proteins in same PDB: d6gvja1
    complexed with cl, gol

Details for d6gvja2

PDB Entry: 6gvj (more details), 2.4099999999999997 Å

PDB Description: human mps1 kinase domain with ordered activation loop
PDB Compounds: (A:) Dual specificity protein kinase TTK

SCOPe Domain Sequences for d6gvja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gvja2 l.1.1.1 (A:754-795) C-terminal Tags {Synthetic}
iefpdipekdlqdvlkcclkrdpkqrisipellahpyvqiqt

SCOPe Domain Coordinates for d6gvja2 are not available.

Timeline for d6gvja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gvja1