Lineage for d6gvja1 (6gvj A:515-753)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. Protein automated matches [190417] (36 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1454 PDB entries)
  8. Domain d6gvja1: 6gvj A:515-753 [362232]
    Other proteins in same PDB: d6gvja2
    automated match to d3dbqa_
    complexed with cl, gol

Details for d6gvja1

PDB Entry: 6gvj (more details), 2.4099999999999997 Å

PDB Description: human mps1 kinase domain with ordered activation loop
PDB Compounds: (A:) Dual specificity protein kinase TTK

SCOPe Domain Sequences for d6gvja1:

Sequence, based on SEQRES records: (download)

>d6gvja1 d.144.1.0 (A:515-753) automated matches {Human (Homo sapiens) [TaxId: 9606]}
necisvkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiay
lnklqqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmlea
vhtihqhgivhsdlkpanflivdgmlklidfgianqmqpdttsvvkdsqvgtvnymppea
ikdmsssrengkskskispksdvwslgcilyymtygktpfqqiinqisklhaiidpnhe

Sequence, based on observed residues (ATOM records): (download)

>d6gvja1 d.144.1.0 (A:515-753) automated matches {Human (Homo sapiens) [TaxId: 9606]}
necisvkgriysilkqigsggsskvfqvlnekkqiyaikyvnleeadnqtldsyrneiay
lnklqqhsdkiirlydyeitdqyiymvmecgnidlnswlkkkksidpwerksywknmlea
vhtihqhgivhsdlkpanflivdgmlklidfgianqmqpdttsvvkdsqvgtvnymppea
ikdmsskispksdvwslgcilyymtygktpfqqiinqisklhaiidpnhe

SCOPe Domain Coordinates for d6gvja1 are not available.

Timeline for d6gvja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gvja2