SCOPe 2.08: Domain d6mivd1: 6miv D:2-112

Lineage for d6mivd1 (6miv D:2-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6mivd1: 6miv D:2-112 [362211]
   Other proteins in same PDB: d6miva1, d6mivb_, d6mivc2
   automated match to d3q5ya1
   complexed with gol, ju1, na, nag

Details for d6mivd1

PDB Entry: 6miv, 2.05 Å

PDB Description: crystal structure of the mcd1d/xxq (jj300)/inktcr ternary complex

PDB Compounds: (D:) Beta-chain,Tcell receptor chain,T cell receptor beta constant 2

SCOPe Domain Sequences for d6mivd1:

Sequence; same for both SEQRES and ATOM records:

>d6mivd1 b.1.1.0 (D:2-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

Timeline for d6mivd1:

• d6mivd1 first appeared in SCOPe 2.07