SCOPe 2.07: Domain d6miyg2: 6miy G:116-204

Lineage for d6miyg2 (6miy G:116-204)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6miyg2: 6miy G:116-204 [362208]
   Other proteins in same PDB: d6miya1, d6miya2, d6miyb_, d6miyc1, d6miyd1, d6miyd2, d6miye1, d6miye2, d6miyf_, d6miyg1, d6miyh1, d6miyh2
   automated match to d2pyfa2
   complexed with cl, fuc, gol, jtv, na, nag

Details for d6miyg2

PDB Entry: 6miy, 2.75 Å

PDB Description: crystal structure of the mcd1d/xxa (jj239)/inktcr ternary complex

PDB Compounds: (G:) T cell receptor alpha variable 11,T cell receptor alpha variable 11,T cell receptor alpha joining 18,Human nkt tcr alpha chain, CHIMERIC PROTEIN

SCOPe Domain Sequences for d6miyg2:

Sequence, based on SEQRES records:

>d6miyg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d6miyg2 b.1.1.2 (G:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnfacanafnnsiipedtffps

Timeline for d6miyg2:

• d6miyg2 is new in SCOPe 2.07-stable
  
• d6miyg2 appears in the current release, SCOPe 2.08