Lineage for d6gtwd_ (6gtw D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767438Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2767443Family b.2.3.2: Pilus subunits [49405] (11 proteins)
  6. 2767660Protein automated matches [190569] (9 species)
    not a true protein
  7. 2767668Species Escherichia coli [TaxId:488477] [232652] (2 PDB entries)
  8. 2767672Domain d6gtwd_: 6gtw D: [362197]
    automated match to d4xocb_
    complexed with ca

Details for d6gtwd_

PDB Entry: 6gtw (more details), 2.5 Å

PDB Description: crystal structure of the fimh lectin domain from e.coli f18 in complex with trimannose
PDB Compounds: (D:) FimH PROTEIN

SCOPe Domain Sequences for d6gtwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gtwd_ b.2.3.2 (D:) automated matches {Escherichia coli [TaxId: 488477]}
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvptg

SCOPe Domain Coordinates for d6gtwd_:

Click to download the PDB-style file with coordinates for d6gtwd_.
(The format of our PDB-style files is described here.)

Timeline for d6gtwd_: