Class a: All alpha proteins [46456] (289 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.0: automated matches [237401] (1 protein) not a true family |
Protein automated matches [237402] (7 species) not a true protein |
Species Zea mays [TaxId:4577] [362160] (2 PDB entries) |
Domain d6h3pb_: 6h3p B: [362193] automated match to d4ppua_ |
PDB Entry: 6h3p (more details), 2.7 Å
SCOPe Domain Sequences for d6h3pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h3pb_ a.130.1.0 (B:) automated matches {Zea mays [TaxId: 4577]} lslaavrdalvrledsvvfalierarhprnapayapaatagehslveffvreaealnaka ghyqkpedvpffpqdlpsplfptkpspkvlhpfaslvtvndaiwkmyfdellplftvdgd dasyaqtvaldlaclqvlsqrihigkyvaevkfkdapqeysrlikekdsnslmdmltfka veekvkkrvekkartfgqnvtlddnatagdseckvdpkvlsklydqwvmpltkdveveyl lrrld
Timeline for d6h3pb_: