Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (21 species) not a true protein |
Species Trypanosoma brucei [TaxId:5702] [362151] (2 PDB entries) |
Domain d6gxgb1: 6gxg B:2-144 [362181] Other proteins in same PDB: d6gxga2, d6gxgb2, d6gxgc2 automated match to d1o73a_ complexed with ffn, gol |
PDB Entry: 6gxg (more details), 1.6 Å
SCOPe Domain Sequences for d6gxgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gxgb1 c.47.1.10 (B:2-144) automated matches {Trypanosoma brucei [TaxId: 5702]} sglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekhhvak nfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitinadtga iigtqartrviedpdganfpwpn
Timeline for d6gxgb1:
View in 3D Domains from other chains: (mouse over for more information) d6gxga1, d6gxga2, d6gxgc1, d6gxgc2 |