Lineage for d6gxgb1 (6gxg B:2-144)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878316Species Trypanosoma brucei [TaxId:5702] [362151] (2 PDB entries)
  8. 2878318Domain d6gxgb1: 6gxg B:2-144 [362181]
    Other proteins in same PDB: d6gxga2, d6gxgb2, d6gxgc2
    automated match to d1o73a_
    complexed with ffn, gol

Details for d6gxgb1

PDB Entry: 6gxg (more details), 1.6 Å

PDB Description: tryparedoxin from trypanosoma brucei in complex with cft
PDB Compounds: (B:) tryparedoxin

SCOPe Domain Sequences for d6gxgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gxgb1 c.47.1.10 (B:2-144) automated matches {Trypanosoma brucei [TaxId: 5702]}
sglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekhhvak
nfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitinadtga
iigtqartrviedpdganfpwpn

SCOPe Domain Coordinates for d6gxgb1:

Click to download the PDB-style file with coordinates for d6gxgb1.
(The format of our PDB-style files is described here.)

Timeline for d6gxgb1: