Class a: All alpha proteins [46456] (290 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.0: automated matches [237401] (1 protein) not a true family |
Protein automated matches [237402] (7 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [362160] (2 PDB entries) |
Domain d6hjwb1: 6hjw B:79-333 [362176] Other proteins in same PDB: d6hjwb2 automated match to d4ppua_ complexed with tyr |
PDB Entry: 6hjw (more details), 2.5 Å
SCOPe Domain Sequences for d6hjwb1:
Sequence, based on SEQRES records: (download)
>d6hjwb1 a.130.1.0 (B:79-333) automated matches {Maize (Zea mays) [TaxId: 4577]} rvdrseiltldsirqvlirledsiifglleraqfcynadtydsnafhmdgfggslveymv reteklhaqvgrykspdehpffpedlpeprlppmqyprvlhpiadsininkeiwkmyfde llprlvkkgsdgnagssalcdttclqalskrihygkfvaeakfqespeaympaiiaqdrd qlmhlltyetveraiehrveakakifgqevnigvedngsppvykivpslvaelysyrimp ltkevqiayllkrld
>d6hjwb1 a.130.1.0 (B:79-333) automated matches {Maize (Zea mays) [TaxId: 4577]} rvdrseiltldsirqvlirledsiifglleraqfcynadtydsnafhmdgfggslveymv reteklhaqvgrykspdehpffpedlpeprlppmqyprvlhpiadsininkeiwkmyfde llprlvkkgsdgnagssalcdttclqalskrihygkfvaeakfqespeaympaiiaqdrd qlmhlltyetveraiehrveakakifgqeykivpslvaelysyrimpltkevqiayllkr ld
Timeline for d6hjwb1: