SCOPe 2.08: Domain d6gxga1: 6gxg A:2-142

Lineage for d6gxga1 (6gxg A:2-142)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (21 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:5702] [362151] (2 PDB entries)

8. Domain d6gxga1: 6gxg A:2-142 [362174]
   Other proteins in same PDB: d6gxga2, d6gxgb2, d6gxgc2
   automated match to d1o73a_
   complexed with ffn, gol

Details for d6gxga1

PDB Entry: 6gxg, 1.6 Å

PDB Description: tryparedoxin from trypanosoma brucei in complex with cft

PDB Compounds: (A:) tryparedoxin

SCOPe Domain Sequences for d6gxga1:

Sequence; same for both SEQRES and ATOM records:

>d6gxga1 c.47.1.10 (A:2-142) automated matches {Trypanosoma brucei [TaxId: 5702]}
sglakylpgatnllsksgevslgslvgktvflyfsaswcppcrgftpvlaefyekhhvak
nfevvliswdenesdfhdyygkmpwlalpfdqrstvselgktfgvesiptlitinadtga
iigtqartrviedpdganfpw

Timeline for d6gxga1:

• d6gxga1 first appeared in SCOPe 2.07