Lineage for d6fgda1 (6fgd A:319-498)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820794Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2820795Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2820796Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2820844Protein automated matches [259253] (1 species)
    not a true protein
  7. 2820845Species Norway rat (Rattus norvegicus) [TaxId:10116] [259254] (9 PDB entries)
  8. 2820847Domain d6fgda1: 6fgd A:319-498 [362148]
    Other proteins in same PDB: d6fgda2, d6fgda3
    automated match to d2ftsa2
    complexed with act, adp, ca, d8z, mpd, na, po4

Details for d6fgda1

PDB Entry: 6fgd (more details), 1.5 Å

PDB Description: crystal structure of gephyrin e domain in complex with artemether
PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d6fgda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fgda1 b.103.1.1 (A:319-498) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav
raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd
gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf

SCOPe Domain Coordinates for d6fgda1:

Click to download the PDB-style file with coordinates for d6fgda1.
(The format of our PDB-style files is described here.)

Timeline for d6fgda1: