Lineage for d6gtwa_ (6gtw A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377244Family b.2.3.2: Pilus subunits [49405] (10 proteins)
  6. 2377427Protein automated matches [190569] (9 species)
    not a true protein
  7. 2377435Species Escherichia coli [TaxId:488477] [232652] (2 PDB entries)
  8. 2377440Domain d6gtwa_: 6gtw A: [362141]
    automated match to d4xocb_
    complexed with ca, man

Details for d6gtwa_

PDB Entry: 6gtw (more details), 2.5 Å

PDB Description: crystal structure of the fimh lectin domain from e.coli f18 in complex with trimannose
PDB Compounds: (A:) FimH PROTEIN

SCOPe Domain Sequences for d6gtwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gtwa_ b.2.3.2 (A:) automated matches {Escherichia coli [TaxId: 488477]}
facktangtaipigggsanvyvnlapavnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlssfsgtvkyngssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d6gtwa_:

Click to download the PDB-style file with coordinates for d6gtwa_.
(The format of our PDB-style files is described here.)

Timeline for d6gtwa_: