Lineage for d6g48b_ (6g48 B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. Superfamily b.85.3: Urease, beta-subunit [51278] (2 families) (S)
  5. Family b.85.3.1: Urease, beta-subunit [51279] (2 proteins)
  6. Protein Urease, beta-subunit [51280] (4 species)
  7. Species Bacillus pasteurii [TaxId:1474] [51282] (18 PDB entries)
  8. Domain d6g48b_: 6g48 B: [362131]
    Other proteins in same PDB: d6g48a_
    automated match to d2ubpb_
    complexed with ag, edo, ni, oh, so4

Details for d6g48b_

PDB Entry: 6g48 (more details), 1.91 Å

PDB Description: sporosarcina pasteurii urease inhibited by silver
PDB Compounds: (B:) urease subunit beta

SCOPe Domain Sequences for d6g48b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6g48b_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]}
nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
ve

SCOPe Domain Coordinates for d6g48b_ are not available.

Timeline for d6g48b_:

Domains from other chains:
(mouse over for more information)
d6g48a_