SCOPe 2.08: Domain d6fgca3: 6fgc A:654-736

Lineage for d6fgca3 (6fgc A:654-736)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families)
   automatically mapped to Pfam PF03454

5. Family b.85.6.0: automated matches [259258] (1 protein)
   not a true family

6. Protein automated matches [259259] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [259260] (9 PDB entries)

8. Domain d6fgca3: 6fgc A:654-736 [362120]
   Other proteins in same PDB: d6fgca1, d6fgca2
   automated match to d2ftsa1
   complexed with act, adp, ca, cl, d95, mpd, mrd, po4

Details for d6fgca3

PDB Entry: 6fgc, 1.5 Å

PDB Description: crystal structure of gephyrin e domain in complex with artesunate

PDB Compounds: (A:) gephyrin

SCOPe Domain Sequences for d6fgca3:

Sequence, based on SEQRES records:

>d6fgca3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp
pkteqyvelhkgevvdvmvigrl

Sequence, based on observed residues (ATOM records):

>d6fgca3 b.85.6.0 (A:654-736) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstglmsmrsangllmlppkteqy
velhkgevvdvmvigrl

Timeline for d6fgca3:

• d6fgca3 first appeared in SCOPe 2.07