Lineage for d1b2xc_ (1b2x C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 75820Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
  4. 75821Superfamily d.1.1: Microbial ribonucleases [53933] (1 family) (S)
  5. 75822Family d.1.1.1: Microbial ribonucleases [53934] (8 proteins)
  6. 75823Protein Barnase/Binase [53944] (2 species)
  7. 75824Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (33 PDB entries)
  8. 75833Domain d1b2xc_: 1b2x C: [36212]

Details for d1b2xc_

PDB Entry: 1b2x (more details), 1.8 Å

PDB Description: barnase wildtype structure at ph 7.5 from a cryo_cooled crystal at 100k

SCOP Domain Sequences for d1b2xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2xc_ d.1.1.1 (C:) Barnase/Binase {Bacillus amyloliquefaciens}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOP Domain Coordinates for d1b2xc_:

Click to download the PDB-style file with coordinates for d1b2xc_.
(The format of our PDB-style files is described here.)

Timeline for d1b2xc_: